GENEMEDICS APP

GENEMEDICS NUTRITION

LL-37

Author: Dr. George Shanlikian, M.D.  |   Last Updated: November 22nd, 2024

Share This Page

Book a Free Consultation

Overall Health Benefits of LL-37

LL-37 benefits include promoting wound healing, enhancing immune responses, and possessing antimicrobial properties that help fight off infections. Additionally, LL-37 can reduce inflammation and aid in tissue regeneration.

  • Significantly boosts immune function [1-19]
  • Fights inflammation [20-29]
  • Prevents cancer progression [30-59]
  • Accelerates wound healing [60-67]
  • Lowers the risk of heart disease [68-70]
  • Prevents lung injury [71-72]
  • Promotes bone repair [73-77]

Key Takeaways

  • Antimicrobial Properties: LL-37 has strong antimicrobial effects, helping to combat bacterial, viral, and fungal infections.
  • Immune System Enhancement: It boosts the immune system, aiding in the body’s defense against pathogens.
  • Wound Healing: LL-37 promotes wound healing by stimulating tissue regeneration and reducing inflammation.
  • Anti-Inflammatory Effects: It reduces inflammation, contributing to overall health and recovery in inflammatory conditions.
  • Tissue Regeneration: LL-37 supports tissue regeneration, aiding in the repair and maintenance of healthy tissues.

What is LL-37?

LL-37, also known as Human Cathelicidin Antimicrobial Peptide (CAMP), is touted as a “mammal’s core tool” to fight off various harmful microorganisms in the body. It’s produced by many cell types including natural killer (NK) cells, white blood cells, and skin cells. In addition, different body systems such as the respiratory system, gastrointestinal tract, testes, and ocular surface also produce LL-37. This powerful peptidehas piqued the interest of the research community because its immune-modulating activities have the potential to accelerate tissue recovery and significantly improve the survival rate of patients with chronic debilitating medical conditions.

How LL-37 Works?

The human cathelicidin LL-37 serves a critical role in the innate immune system by defending against bacterial infections. LL-37 can interact with the molecules of the cell wall and perforate cytoplasmic membranes resulting in bacterial cell death. In addition, LL-37 helps promote wound closure by stimulating the formation of new blood vessels (angiogenesis).

Chemical Structure of LL-37

Research on LL-37

A. Significantly Boosts Immune Function

Boost the Immune System to Keep You Healthy

LL-37 significantly boosts immune function by directly attacking and breaking down bacterial cell walls, leading to rapid bacterial death. It enhances the body’s innate immune defenses by not only acting as an antimicrobial peptide but also by modulating immune responses. LL-37 recruits immune cells to infection sites, reduces inflammation, and promotes wound healing through angiogenesis, thus enhancing the body’s ability to respond to and recover from infections and tissue damage.

  1. LL-37 boosts immune function by limiting the damage caused by bacterial products and recruiting immune cells to the site of infection. [1]
  2. A cell study found that LL-37 has the ability to inhibit the formation of bacterial biofilms (densely packed communities of microbial cells). [2]
  3. A cell study also found that LL-37 may help enhance the immunomodulatory function of human placenta-derived MSCs (pMSCs). [3]
  4. A study found that LL-37 was deadly against Staphylococcus aureus, the most common cause of upper respiratory tract infections. [4]
  5. LL-37 demonstrated strong antimicrobial activity against eye pathogens (infectious microorganisms). [5]
  6. Studies showed that LL-37 destroyed harmful microorganisms by inducing programmed cell death (apoptosis). [6-8]
  7. A study found that LL-37 can kill a broad spectrum of bacteria. [9-10]
  8. LL-37 boosts immune response by attracting immune cells including T cells, monocytes, neutrophils, and mast cells to the site of infection. [11-12]
  9. LL-37 also affects the maturation of dendritic cells (antigen-presenting cells). [13]
  10. LL-37 stimulates the production of immune cells such as cytokines, chemokines, and their receptors. [14-15]
  11. Higher blood levels of LL-37 were associated with a lower risk of death from infection in dialysis patients. [16]
  12. In patients with psoriasis, LL-37 worked synergistically with human beta-defensin 2 (HBD-2) in killing Staphylococcus aureus (S. aureus) bacteria. [17]
  13. A study showed that LL-37 may be beneficial in treating patients with sepsis. [18]
  14. A study showed that LL-37 enhanced the effects of lysozyme against S. aureus. [19]

B. Fights Inflammation

Fight Health Robbing Inflammation With Simple Steps

LL-37 fights inflammation by modulating the immune response; it does this by binding to specific cell receptors and signaling pathways that regulate inflammation. This peptide reduces pro-inflammatory cytokine release, prevents excessive immune cell activation, and encourages the production of anti-inflammatory molecules. Through these actions, LL-37 helps maintain immune balance, reducing chronic inflammation and promoting healing in inflamed tissues.

  1. In patients who had surgical removal of the tonsils, those with high levels of LL-37 had lesser inflammation compared to those with low LL-37. [20]
  2. LL-37 suppresses the translocation of NF-kB to the nucleus, which creates an anti-inflammatory effect. [21]
  3. In mice, LL-37 administration reduced the risk of inflammatory disease. [22]
  4. LL-37 reduces inflammation by modulating inflammatory pathways in the body. [23-25]
  5. In human gum cells, LL-37 strongly reduced the levels of pro-inflammatory cytokines and chemokines. [26]
  6. LL-37 also modulates the inflammatory and host defense response of human white blood cells. [27]
  7. In mouse models, LL-37 provided protection against collagen damage which normally occurs in inflammatory arthritis. [28]
  8. A study showed that LL-37 was effective in regulating inflammation induced by interleukin-32. [29]

C. Prevents Cancer Progression

LL-37 prevents cancer progression by modulating the immune response and affecting tumor cell behavior. It can inhibit tumor cell proliferation, migration, and invasion by interfering with signaling pathways essential for cancer growth. Additionally, LL-37 promotes an anti-tumor immune environment by activating immune cells that target cancer cells, helping to reduce metastasis and tumor expansion.

  1. A cell study found that LL-37 has the potential to suppress cancer growth. [30]
  2. In another cell study, LL-37 suppressed the growth of colon cancer by inducing programmed cell death. [31]
  3. A study found that LL-37 has an anti-cancer effect in colon cancer, gastric cancer, skin cancer, ovarian cancer, lung cancer, breast cancer, prostate cancer, hematologic malignancy, and oral cancer. [32]
  4. In various human cancer cell lines, LL-37 exhibited anti-cancer effects similar to chemotherapeutic drugs. [33]
  5. In human lung cancer cell lines, LL-37 suppressed cancer progression by reducing the production of pro-inflammatory cytokines. [34]
  6. Cell studies have shown that LL-37 can inhibit the migration and invasiveness of prostate cancer cells. [35-40]
  7. In colon cancer, gastric cancer, and skin cancer cell lines, treatment with LL-37 prevented cancer cell progression.[41-46]
  8. In colon cancer cell lines, LL-37 destroyed cancer cells by stimulating signaling pathways involved in programmed cell death. [47-51]
  9. In gastric cancer cell lines, LL-37 inhibited gastric cancer cell proliferation through activation of signaling pathways involved in cell cycle arrest. [52-55]
  10. In leukemic cell lines, recombinant LL-37 treatment killed malignant cells by activating programmed cell death. [56-57]
  11. In human oral cancer cell lines, treatment with LL-37 destroyed malignant cells by damaging their DNA. [58-59]

D. Accelerates Wound Healing

LL-37 accelerates wound healing by promoting angiogenesis, which is the formation of new blood vessels essential for tissue repair. It stimulates cells involved in wound closure, such as keratinocytes and fibroblasts, enhancing cell migration and proliferation at the wound site. Additionally, LL-37 has anti-inflammatory and antimicrobial properties that reduce infection risk, creating an optimal environment for healing to proceed efficiently.

  1. In patients with venous leg ulcers, LL-37 treatment was associated with a faster healing rate (almost six-fold higher) compared to placebo. [60]
  2. In mice, LL-37 treatment promoted wound healing through the production of new blood vessels. [61]
  3. A cell study found that LL-37 induces wound healing by stimulating the proliferation and migration of cells necessary for regeneration. [62]
  4. In mice, LL-37 treatment improved re-epithelialization and granulation tissue formation – both of these processes are necessary for wound healing. [63-64]
  5. Cell studies found that LL-37 improves wound healing through its antimicrobial activity. [65-66]
  6. In patients with venous leg ulcers, low-dose LL-37 treatment markedly decreased the mean ulcer area. [67]

E. Lowers the Risk of Heart Disease

LL-37 lowers the risk of heart disease primarily through its anti-inflammatory and antimicrobial effects, which help reduce chronic inflammation and infection-related risks that contribute to heart disease. Additionally, LL-37 promotes the repair and stability of blood vessels by encouraging angiogenesis (new blood vessel formation) and aiding in the prevention of plaque buildup in arteries, thus supporting healthier cardiovascular function.

  1. A study showed that LL-37 can protect against atherosclerosis (plaque build-up within the heart arteries). [68]
  2. A study also found that LL-37 inhibited cell death in the heart, suggesting that increasing its level might have therapeutic benefits against heart failure. [69]
  3. In mice, heart failure was associated with a decrease in LL-37 levels and this deficiency worsened the condition. [70]

F. Prevents Lung Injury

LL-37 helps prevent lung injury by modulating immune responses and reducing inflammation in the lung tissue. It inhibits pro-inflammatory cytokines while promoting anti-inflammatory pathways, limiting excessive immune reactions that can damage lung cells. Additionally, LL-37 enhances the clearance of pathogens, minimizing infections that often lead to lung injury. This protective action supports respiratory health by preventing tissue damage and promoting lung healing processes.

  1. In mice, LL-37 attenuated the progression of lung injury by controlling inflammation and preventing infection. [71]
  2. A study reported that LL-37 is an effective inflammatory regulator in various lung diseases. [72]

G. Promotes Bone Repair

LL-37 promotes bone repair by enhancing the recruitment and activity of osteoblasts, the cells responsible for bone formation. It stimulates the production of growth factors and cytokines that aid in bone regeneration, and it also supports angiogenesis, ensuring an adequate blood supply to the damaged bone area. These combined actions help accelerate the healing process and strengthen bone tissue.

  1. A mice study found that LL-37-treated white blood cells promoted bone formation. [73]
  2. Cell studies also found that LL-37 can help prevent bone disorders by inhibiting bone breakdown. [74-75]
  3. In rats with bone defects, LL-37 treatment markedly induced newly formed bones. [76]
  4. A cell study reported that LL-37 induced bone formation by recruiting stem cells into the site of injury. [77]

LL-37 Side Effects

LL-37 side effects are very uncommon. There have been some side effects associated with the use of this drug wherein the patient had one of the issues listed below at some point while being on LL-37. However, these side effects weren’t confirmed to be associated with the treatment and could have been a coincidence and not related to the use of LL-37. Despite this, it was listed as a side effect associated with LL-37 even though these associated side effects are very uncommon.

Side effects associated with LL-37 may include the following:

  • Increased inflammation
  • Induction of autoimmune disease
  • Depression
  • Damage to sperm surface membranes

LL 37 Sequence

LL-37, a human antimicrobial peptide, is composed of 37 amino acids, hence the designation “LL-37.” The sequence of LL-37 is [LL-37, 37 aa], a structure that plays a crucial role in its biological functions. The amphipathic nature of LL-37, with both hydrophilic and hydrophobic regions, allows it to interact with and disrupt microbial membranes, thereby exerting its potent antimicrobial effects.

The sequence of LL-37 is not only essential for its antimicrobial properties but also for its role in modulating the immune system. Specific amino acid residues within the sequence are responsible for binding to and neutralizing lipopolysaccharides (LPS), which are components of the outer membrane of Gram-negative bacteria. By neutralizing LPS, LL-37 helps to prevent excessive inflammatory responses, thus protecting the host from potential damage due to overactive immune reactions.

Furthermore, the sequence of LL-37 is involved in signaling pathways that promote wound healing and tissue regeneration. For instance, certain segments of the peptide can interact with cell surface receptors, triggering pathways that lead to increased cell proliferation and migration. This makes LL-37 a valuable component not only in the innate immune response but also in the processes of healing and tissue repair.

Cathelicidin LL 37

Cathelicidin LL-37 is a crucial component of the innate immune system, known for its broad-spectrum antimicrobial properties. It is a peptide derived from the precursor protein hCAP18, which is produced by various cells, including white blood cells and epithelial cells. LL-37 is effective against a wide range of pathogens, including bacteria, viruses, and fungi, making it a vital first line of defense against infections. Its ability to disrupt microbial membranes and inhibit biofilm formation enhances its role in protecting the body from infectious agents.

Beyond its antimicrobial functions, LL-37 also plays a significant role in modulating the immune response. It acts as a signaling molecule, influencing the activity of immune cells such as macrophages and neutrophils. This peptide can attract immune cells to sites of infection or injury, promoting inflammation to combat pathogens. Additionally, LL-37 helps to regulate the balance between pro-inflammatory and anti-inflammatory responses, ensuring that the immune reaction is effective without causing excessive tissue damage.

LL-37’s contributions extend to wound healing and tissue regeneration. By promoting the migration and proliferation of skin cells, it accelerates the repair of damaged tissues. Its anti-inflammatory properties also help to minimize chronic inflammation, which can impede the healing process. Research has shown that LL-37 can stimulate angiogenesis, the formation of new blood vessels, further supporting tissue repair and regeneration. These multifaceted roles make LL-37 a peptide of great interest in the development of new therapeutic approaches for infections, inflammatory diseases, and wound healing.

LL 37 Peptide Dosage

Determining the appropriate dosage of LL-37 peptide is crucial for maximizing its benefits while minimizing potential side effects. The optimal dosage can vary depending on the intended use, whether it is for wound healing, antimicrobial purposes, or immune system enhancement. Typically, LL-37 is administered through injections, with common dosages ranging from 50 to 100 micrograms per injection. However, the exact dosage and frequency should be tailored to the individual’s needs and health conditions, often under the guidance of a healthcare professional.

The administration of LL-37 requires careful consideration of factors such as the severity of the condition being treated, the patient’s overall health, and any concurrent treatments. For instance, in the case of chronic infections or severe wounds, a higher dosage or more frequent administration might be necessary. Conversely, for general immune support or maintenance, a lower dosage might suffice. It’s important to start with a lower dosage and gradually adjust based on the body’s response and any observed side effects.

Monitoring and adjusting the dosage of LL-37 is an ongoing process. Regular consultations with a healthcare provider are essential to ensure the treatment’s efficacy and safety. Potential side effects, such as irritation at the injection site or systemic inflammatory responses, should be closely monitored. By maintaining a personalized and flexible approach to LL-37 peptide dosage, patients can harness its therapeutic benefits effectively while mitigating risks.

What is a Human Antimicrobial Peptide?

Human antimicrobial peptides (AMPs) are small, naturally occurring molecules found in the human body that play a critical role in the innate immune system. These peptides, which typically consist of 12 to 50 amino acids, possess the ability to destroy a wide range of pathogens, including bacteria, viruses, and fungi. AMPs are produced by various cells and tissues, particularly those that are in constant contact with the external environment, such as the skin, respiratory tract, and gastrointestinal tract. They serve as a first line of defense, rapidly neutralizing potential threats before they can cause infection or disease.

One of the key features of AMPs is their broad-spectrum antimicrobial activity. Unlike traditional antibiotics, which are often specific to certain types of bacteria, AMPs can target a diverse array of microorganisms. This is achieved through mechanisms such as disrupting the microbial cell membrane, thereby causing cell lysis and death. Additionally, AMPs can modulate the host’s immune response, enhancing the ability of immune cells to combat infections. This dual functionality not only helps in directly eliminating pathogens but also in orchestrating a more effective immune response.

Furthermore, AMPs like LL-37 have been found to possess additional biological functions beyond their antimicrobial properties. They can promote wound healing by stimulating cell proliferation and migration, and by reducing inflammation at the site of injury. This makes them not only crucial for fighting infections but also for maintaining overall tissue health and integrity. As research into AMPs continues, their potential therapeutic applications are becoming increasingly evident, offering promising alternatives to conventional antibiotics and treatments for various infectious and inflammatory diseases.

Antimicrobial Peptide LL 37 and other Antimicrobial Peptides

Antimicrobial peptides (AMPs) like LL-37 are a crucial component of the innate immune system, providing a rapid and effective defense against a broad spectrum of pathogens. LL-37, derived from the human cathelicidin antimicrobial peptide, has been extensively studied for its potent antimicrobial properties. It can neutralize bacteria, viruses, and fungi by disrupting their cell membranes, thus preventing infection and promoting healing. LL-37 also has immunomodulatory functions, enhancing the immune system’s response and aiding in the control of inflammation.

Other antimicrobial peptides, such as defensins and magainins, share similar protective roles in various organisms. Defensins, found in humans and many other species, contribute to the immune response by destroying pathogens and recruiting immune cells to infection sites. Magainins, originally discovered in frogs, have shown remarkable effectiveness against a range of microbial infections and are being explored for their potential in developing new therapeutic agents. Each AMP has unique structural features and modes of action, making them versatile tools in the fight against infectious diseases.

The therapeutic potential of AMPs extends beyond their natural roles in immunity. Researchers are investigating their use in treating antibiotic-resistant infections, wound healing, and inflammatory diseases. LL-37, for example, has shown promise in clinical settings for its ability to accelerate tissue repair and reduce inflammation. As antibiotic resistance becomes an increasing global threat, the exploration and development of AMPs offer a promising avenue for new treatments, harnessing the power of these naturally occurring peptides to enhance human health and combat infections.

LL-37 Nasal Spray

LL-37 nasal spray leverages the potent antimicrobial and anti-inflammatory properties of the LL-37 peptide to combat respiratory infections and inflammation. By delivering LL-37 directly to the nasal passages, the spray can target pathogens that cause upper respiratory infections such as colds, sinusitis, and influenza. The localized application helps to maximize the peptide’s effectiveness in eliminating harmful bacteria, viruses, and fungi, providing a powerful tool against common respiratory ailments.

In addition to its antimicrobial benefits, LL-37 nasal spray also plays a significant role in reducing inflammation in the nasal passages and sinuses. This can alleviate symptoms associated with chronic rhinosinusitis, allergic rhinitis, and other inflammatory conditions of the upper respiratory tract. By decreasing inflammation, the spray can improve breathing, reduce nasal congestion, and enhance overall nasal health, providing relief to individuals suffering from these chronic conditions.

Furthermore, LL-37 nasal spray promotes tissue repair and regeneration in the nasal passages. This is particularly beneficial for individuals with damaged or irritated nasal tissues due to frequent infections, allergies, or environmental irritants. The peptide’s ability to stimulate tissue regeneration helps to restore the integrity of the nasal mucosa, leading to improved function and resilience of the lipid bilayers nasal passages. Overall, LL-37 nasal spray offers a multifaceted approach to enhancing respiratory health through its antimicrobial, anti-inflammatory, and tissue-regenerative properties.

LL 37 Peptide Bodybuilding

LL-37 peptide has garnered attention in the bodybuilding community for its potential benefits beyond traditional muscle-building supplements. This naturally occurring peptide, known for its antimicrobial properties, also plays a significant role in enhancing the immune system, which is crucial for bodybuilders who undergo intense training and are at risk of infections. By fortifying the body’s defenses, LL-37 helps athletes maintain their health and continue their rigorous workout routines without interruptions caused by illness.

In addition to immune support, LL-37 contributes to improved recovery times, a critical factor in bodybuilding. Its anti-inflammatory properties aid in reducing muscle soreness and inflammation that often follow strenuous workouts. This allows bodybuilders to train more frequently and with greater intensity, leading to faster gains in muscle mass and strength. The peptide also promotes wound healing and tissue regeneration, which can be particularly beneficial for those recovering from injuries or dealing with minor muscle tears and strains. The role of lipid bilayers is crucial in understanding how LL-37 interacts with cell membranes and exerts its effects.

Furthermore, LL-37’s role in promoting overall health extends to enhancing skin quality and reducing the risk of skin infections, which can be a concern for athletes who sweat heavily and are prone to skin issues. By supporting lipid bilayers skin health, LL-37 ensures that bodybuilders can maintain a clear and healthy complexion, contributing to their overall aesthetic appeal. With its multifaceted benefits, LL-37 peptide emerges as a valuable supplement for bodybuilders aiming to optimize their health, recovery, and performance.

LL 37 Herpes

LL-37, a naturally occurring antimicrobial peptide in the body, shows promise in managing herpes infections. Research suggests that LL-37 can inhibit the replication of herpes simplex viruses (HSV), which cause oral and genital herpes. By disrupting viral entry into cells and interfering with viral replication processes within the outer membrane, LL-37 demonstrates potential as a therapeutic agent against HSV. This peptide’s ability to enhance immune responses further supports its role in controlling herpes outbreaks and reducing the severity of symptoms associated with skin infections the outer membrane.

Studies exploring LL-37’s effectiveness against herpes have highlighted its dual action of directly combating the virus and modulating immune responses in the outer membrane. This dual mechanism not only targets the virus itself but also strengthens the body’s ability to fight off infections involving the outer membrane. By boosting innate immunity and promoting faster healing of herpes lesions, LL-37 offers a multifaceted approach to managing this persistent viral infection, particularly in areas involving the outer membrane.

Despite these promising findings, further research is needed to fully understand the clinical implications of LL-37 in herpes treatment, especially concerning the outer membrane. Challenges such as delivery methods and optimizing therapeutic concentrations in affected tissues, including those in the hydrophobic residues outer membrane, remain to be addressed. Nonetheless, LL-37’s potential as a novel therapeutic option underscores ongoing efforts to harness natural peptides for combating viral infections like herpes effectively, with a particular focus on the outer membrane hydrophobic residues. By targeting the outer membrane, LL-37 could enhance antiviral strategies and improve patient outcomes.

LL-37 Peptide Dosage

The dosage of LL-37 peptide can vary depending on its intended use and the specific condition being treated. Generally, LL-37 is administered in controlled doses to achieve therapeutic effects without adverse reactions. For topical applications, such as wound healing or skin conditions, concentrations typically range from 0.1% to 2%, applied directly to the affected area. This ensures direct exposure to the peptide’s antimicrobial and healing properties.

In cases where LL-37 is used systemically, such as in immune modulation therapies or experimental treatments, dosages are carefully calibrated based on factors like body weight, medical history, and the severity of the condition. Researchers and healthcare providers determine these doses through clinical trials and studies to optimize effectiveness while minimizing potential side effects.

It’s crucial to note that LL-37’s therapeutic use in rheumatoid arthritis is still evolving, with ongoing research exploring its broader applications and optimal dosing strategies. Clinicians and researchers continue to refine dosage guidelines to maximize its benefits in rheumatoid arthritis across various medical contexts, ensuring safe and effective treatment outcomes.

Share This Page

FAQ

What does LL-37 peptide do?

LL-37 peptide, also known as cathelicidin LL-37, functions as an antimicrobial peptide that helps defend against infections by bacteria, viruses, and fungi. As a human host defense peptide, cathelicidin LL-37 also plays roles in wound healing, inflammation modulation, and immune system regulation. This human peptide host defense peptide, cathelicidin LL-37, is crucial in maintaining overall health. By acting as a human host defense peptide, cathelicidin LL-37 ensures a robust response to various pathogens. The understanding of cathelicidin LL-37’s role in disease pathogenesis underscores its significance in biomedical research and therapeutic development.

What are the most effective antimicrobial peptides?

Some of the most effective antimicrobial peptides include LL-37, human beta-defensins (HBDs), and various peptides derived from frogs and other animals known for their antimicrobial properties due to their strong antimicrobial activity. Cathelicidin LL-37 peptides exhibit significant antimicrobial activity, making them potent agents in combating infections. The study of cathelicidin LL-37 antimicrobial activity continues to reveal new insights into their potential therapeutic uses in bacterial surface interactions. These peptides, including cathelicidin LL-37, exhibit significant antimicrobial activity, making them potent agents in combating infections.

What is human cathelicidin?

Human cathelicidin refers to a family of antimicrobial peptides produced in various tissues, primarily by neutrophils, epithelial cells, and amyloid beta, the only human member. LL-37 is the most studied cathelicidin peptide in humans and is known for its strong antimicrobial activity. The antimicrobial activity of LL-37, crucial in the body’s defense mechanisms, includes amyloid beta, the only human member. Studies have shown that amyloid beta and the antimicrobial activity of LL-37 helps protect against a wide range of pathogens.

What does antimicrobial peptide do?

Antimicrobial peptides, like cathelicidin antimicrobial peptide LL-37, serve as natural defense molecules that can kill microbes directly or modulate immune responses to combat infections. They exhibit strong cathelicidin antimicrobial peptide antimicrobial activity, which makes them effective in fighting off various pathogens. They also contribute to cathelicidin antimicrobial peptide wound healing and tissue repair, further highlighting their essential role in the body’s cathelicidin antimicrobial peptide antimicrobial activity. Researchers are continuously exploring the potential of these cathelicidin antimicrobial peptide peptides due to their significant cathelicidin antimicrobial peptide antimicrobial activity and their ability to enhance immune defense mechanisms.

What is LL-37 in saliva?

LL-37 in saliva likely serves a protective role against oral pathogens, contributing to oral health by its antimicrobial actions and potentially influencing immune responses in the bacterial cell envelope in the oral cavity. The presence of LL-37 helps combat bacteria by targeting the bacterial cell envelope, thereby maintaining oral hygiene. Moreover, LL-37’s role in modulating innate and adaptive immunity immune responses further underscores its importance in protecting the bacterial cell envelope in the oral environment. This peptide also interacts with human cells in the oral mucosa, potentially influencing their innate and adaptive immunity immune responses.

What is LL-37 in psoriasis?

In psoriasis, LL-37 is involved in the pathogenesis of the disease. It can form complexes with self-DNA and trigger immune responses that exacerbate inflammation, contributing to the characteristic proteolytic degradation of skin lesions of psoriasis. LL-37’s role in psoriasis has been studied extensively in clinical infectious diseases, highlighting its significant impact on disease progression and immune dysregulation. LL-37 interacts with the cell wall of pathogens and modulates immune responses. The presence of LL-37 on the cell wall affects microbial virulence and survival. Understanding LL-37’s interaction with the cell wall provides insights into host-pathogen interactions. The cell wall composition influences LL-37’s antimicrobial activity. LL-37 binds to the bacterial cell wall and disrupts membrane integrity. The cell wall components affect LL-37’s efficacy against different pathogens. LL-37’s binding to the cell wall enhances bacterial clearance by immune cells. This interaction with the cell wall is crucial for LL-37’s immunomodulatory effects.

What is cathelicidin used for?

Cathelicidin peptides like LL-37 are used for their antimicrobial properties against gram negative bacteria, wound healing capabilities, including promoting epithelial cell migration, and modulation of immune responses against gram negative bacteria. They are being studied for potential therapeutic applications in infections caused by gram negative bacteria, promoting epithelial cell migration in response to gram negative bacteria, and inflammatory conditions. These peptides interact with the gram negative bacteria’s cell wall, aiding in their antimicrobial effects and promoting healing processes.

What does LL-37 do?

LL-37 peptide acts as a multifunctional peptide involved in antimicrobial defense, wound healing, immune modulation, and inflammation regulation, contributing to overall immune health and tissue repair. Its antimicrobial activity is attributed to its ability to induce membrane disruption in gram negative bacteria, pathogens, thereby aiding in immune defense. This membrane disruption capability also facilitates wound healing processes and contributes to the modulation of inflammation, reinforcing its role in maintaining tissue integrity and immune function.

What is the size of LL-37?

LL-37 is a relatively small peptide consisting of 37 amino acids, hence its name. It has a molecular weight of approximately 4.5 kDa. LL-37 is known for its antimicrobial properties, which enable it to interact with gram negative bacteria bacterial cells, disrupting their cytoplasmic membrane and leading to cell death. These interactions make LL-37 a promising candidate for therapeutic applications against various infections caused by gram negative bacteria bacterial cells.

What is antimicrobial peptide used for?

Antimicrobial peptides, including LL-37, are used to combat infections caused by gram negative bacteria, gram negative bacteria, viruses, and gram negative bacteria fungi. They are also studied for their potential in wound healing, inflammation modulation, and immune system support. LL-37, a member of the human cationic antimicrobial protein LL-37 family, is particularly noted for its antimicrobial properties and its role in promoting immune responses and tissue repair. LL-37, a member of the human cationic antimicrobial protein LL-37 family, is particularly noted for its antimicrobial properties and its role in promoting immune responses and tissue repair.

What is the molecular weight of LL-37 in kDa?

LL-37, a human cationic antimicrobial protein, a cationic antimicrobial peptide, has a molecular weight of approximately 4.5 kDa. This human cationic antimicrobial protein is crucial in innate immune responses, serving as a multifunctional molecule involved in antimicrobial defense, wound healing, and inflammation modulation. LL-37’s small size facilitates its rapid diffusion to target sites, enhancing its effectiveness in innate immune responses. LL-37 is also implicated in certain autoimmune diseases, playing a role in autoimmune diseases such as lupus and psoriasis. Its multifunctional nature extends to autoimmune diseases, where LL-37’s involvement influences disease progression and immune responses.

What is LL-37 used for?

LL-37 is used for its antimicrobial properties, wound healing abilities, and its role in modulating innate immune responses, making it potentially valuable in treating infections and inflammatory conditions. LL-37’s antimicrobial properties are particularly effective against invasive bacterial infections, making it a promising candidate for therapeutic applications in combating invasive bacterial infection.

What is the purpose of cathelicidin?

The purpose of cathelicidin peptides like LL-37 is to defend against microbial pathogens, promote tissue repair, and regulate immune responses to maintain overall health and protect against infections. Cathelicidin peptides like LL-37 act by disrupting the integrity of the inner bacterial membrane of pathogens, thereby neutralizing their threat and aiding in the restoration of affected tissues. This dual action supports immune function by assisting in the removal of pathogens and fostering tissue recovery, essential for overall health maintenance and defense against infections. LL-37 also plays a crucial role in modulating the inflammatory response, balancing immune reactions to prevent excessive tissue damage while effectively combating bacterial membranes microbial threats.

What drug is cathelicidin?

Cathelicidin is not a drug itself but refers to a family of antimicrobial peptides naturally produced in the body. LL-37, a member of this human cathelicidin family, is being studied for potential therapeutic applications. LL-37’s antimicrobial properties are particularly noteworthy due to its ability to target a wide range of pathogens by disrupting bacterial cell wall components, thereby triggering a human cathelicidin inflammatory response. This characteristic makes it a promising candidate for treating infections that are resistant to traditional antibiotics, promoting a human cathelicidin inflammatory response.

What is the effect of LL-37 on anti-infective immunity?

LL-37, also known as human cathelicidin, enhances anti-infective immunity by directly killing pathogens and by modulating immune responses, which can help in combating infections effectively. LL-37’s direct antimicrobial action, facilitated by human cathelicidin, disrupts bacterial cell wall components, thereby inhibiting bacterial growth and promoting pathogen clearance. Additionally, LL-37’s ability to modulate immune responses, involving human cathelicidin, enhances the body’s defense mechanisms against infections, further bolstering its efficacy in combating microbial threats. This dual action, mediated by human cathelicidin, involves enhancing the inflammatory response, ensuring a robust defense against pathogens.

What are antimicrobial peptides for UTI?

Antimicrobial peptides, including LL-37, have been studied for their potential use in treating urinary tract infections (UTIs) caused by bacteria. LL-37’s effectiveness lies in its ability to target and disrupt bacterial cell wall components, which are crucial for the survival and virulence of pathogens in the urinary tract. This peptide’s mechanism of action involves directly interacting with human cathelicidin bacterial cell wall components, leading to membrane destabilization and ultimately human cathelicidin bacterial cell death. Such targeted actions make LL-37 a promising candidate for combating UTIs, especially against antibiotic-resistant strains that pose significant challenges in clinical settings. The inflammatory response triggered by LL-37 further enhances its therapeutic potential by promoting immune cell activation and cytokine production, thereby aiding in the resolution of UTIs through multiple pathways.

What does peptide LL-37 do?

LL-37 peptide, also known as human cathelicidin LL-37, acts as an antimicrobial agent, promoting wound healing, modulating inflammation, and regulating immune responses, contributing to overall health and defense against infections. Human cathelicidin LL-37 is particularly crucial in innate immunity, directly combating pathogens and supporting tissue repair processes. Its role in innate immunity extends to modulating inflammation and enhancing immune responses, further bolstering its significance in maintaining health and combating infections.

Where is LL-37 found?

LL-37, also known as human cathelicidin LL-37, is found in various tissues and fluids of the body, including skin, saliva, respiratory tract, and the gastrointestinal tract, where cationic antimicrobial peptides it serves its antimicrobial and immunomodulatory functions. LL-37, cationic antimicrobial peptides LL-37 plays a crucial role in innate immunity by directly combating pathogens and modulating immune responses in these diverse bodily locations.

What are the benefits of LL-37?

The benefits of human cathelicidin LL-37 include its antimicrobial properties against a wide range of pathogens, its role in wound healing, modulation of inflammation, and support for immune system function. Human cathelicidin LL-37, a type of cationic antimicrobial peptides, contributes to innate immunity by directly combating microbes, facilitating tissue repair, and regulating inflammatory responses to enhance overall health and resistance to infections.

What is the function of LL-37?

The function of LL-37, cationic antimicrobial peptides human cathelicidin LL-37, includes antimicrobial defense against bacterial infections, wound healing promotion, inflammation regulation, and immune system modulation, contributing to overall health and disease resistance. Cationic antimicrobial peptides human cathelicidin LL-37 is known for its antimicrobial defense against bacterial infections, promoting wound healing, regulating inflammation, and modulating the immune system, thereby contributing significantly to overall health and disease resistance.

What is the significance of LL-37 on immunomodulation and disease outcome?

LL-37’s role in immunomodulation helps regulate immune responses, influencing disease outcomes in infections, inflammatory conditions, and potentially autoimmune disorders. Studies involving human gingival fibroblasts have shown that LL-37 can significantly affect the immune system’s behavior. The interaction of LL-37 with human gingival fibroblasts may also contribute to its ability to modulate inflammation and promote tissue repair. Thus, understanding LL-37’s effects on human gingival fibroblasts and its interaction with epidermal growth factor receptor is crucial for developing targeted therapies for various diseases.

Is cationic antimicrobial peptide LL-37 effective against both extracellular and intracellular Staphylococcus aureus?

Yes, LL-37 has demonstrated effectiveness against both extracellular and intracellular forms of Staphylococcus aureus, highlighting its broad antimicrobial capabilities. LL-37 also interacts with dendritic cells, enhancing their ability to initiate immune responses. Additionally, the presence of epidermal growth factor receptor LL-37 in various tissues, including its impact on dendritic cells, underscores its multifunctional role in the immune system. This interaction with dendritic cells further illustrates LL-37’s significance in modulating immune defenses and combating infections.

How is cathelicidin produced?

Cathelicidin peptides like LL-37 are produced in various tissues, including human dendritic cells, by proteolytic cleavage of larger precursor proteins, typically in response to infection or inflammation. Human dendritic cells play a key role in initiating immune responses, and the production of LL-37 by these cells enhances their antimicrobial capabilities. Additionally, human dendritic cells contribute to the modulation of immune responses through the activity of cathelicidin peptides like LL-37.

What is a high range for herpes?

A high range for herpes typically refers to a significant increase in viral load or antibody titers, indicating active infection or recent exposure. Dendritic cells play a crucial role in recognizing and responding to herpes virus infections, particularly in how they interact with the bacterial membrane. These dendritic cells are essential in initiating immune responses and managing the viral load. Understanding how dendritic cells interact with the herpes virus and the bacterial membrane can help in developing targeted therapies for active infections or recent exposures. By studying the interaction between dendritic cells, the herpes virus, and the bacterial membrane, researchers can gain valuable insights into more effective treatments.

What is a positive herpes score?

A positive herpes score generally indicates the presence of antibodies against herpes simplex virus (HSV), suggesting either current infection or past exposure. In cases involving human bronchial epithelial cells, detecting these antibodies can be crucial for understanding the spread of HSV in respiratory tissues, especially in individuals with systemic lupus erythematosus. This is particularly important since human bronchial epithelial cells can also be a site of viral infection. Therefore, a positive herpes score in the context of human bronchial epithelial cells highlights the need for further investigation and potential treatment, especially in the presence of systemic lupus erythematosus. Additionally, systemic lupus erythematosus patients may require more careful monitoring due to their potentially compromised immune systems.

What is herpes virus type 7 (HH7)?

Herpesvirus type 7 (HHV-7) is a virus belonging to the Herpesviridae family, closely related to HHV-6. The amino acid sequence of HHV-7 can cause roseola, a common childhood illness, and has been associated with other diseases involving reactive oxygen species. The involvement of reactive oxygen species in the pathogenesis of HHV-7-related conditions highlights the importance of oxidative stress in viral infections. Understanding the role of reactive oxygen species and the amino acid sequence can provide insights into potential therapeutic approaches for managing HHV-7 and its associated diseases. Further research into the amino acid sequence of HHV-7 may reveal more about its mechanisms and potential treatments.

What is L-lysine and herpes?

Human antimicrobial peptide L-lysine is an amino acid supplement often used to manage herpes simplex virus infections. It is believed to reduce viral replication and frequency of outbreaks, although scientific evidence is mixed. By understanding how human antimicrobial peptide works in conjunction with L-lysine and amino acid sequence, researchers hope to uncover new therapeutic approaches. Human antimicrobial peptide is an area of active research due to its potential in reducing viral loads. Using human antimicrobial peptide with L-lysine and amino acid sequence might enhance the efficacy against herpes simplex virus.

Reference

  1. Scott MG, Davidson DJ, Gold MR, Bowdish D, Hancock RE. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. J Immunol. 2002;169(7):3883-91.

  2. Overhage J, Campisano A, Bains M, Torfs EC, Rehm BH, Hancock RE. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-82.

  3. Oliveira-Bravo M, Sangiorgi BB, Schiavinato JL, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016;7(1):189. Published 2016 Dec 30. doi:10.1186/s13287-016-0448-3.

  4. Aboualaiwa MH, Reznikov LR, Gansemer ND, et al. pH modulates the activity and synergism of the airway surface liquid antimicrobials β-defensin-3 and LL-37. ProcNatlAcadSci USA. 2014;111(52):18703-8.

  5. Huang LC, Petkova TD, Reins RY, Proske RJ, Mcdermott AM. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface. Invest Ophthalmol Vis Sci. 2006;47(6):2369-80.

  6. De yang, Chen Q, Schmidt AP, et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J Exp Med. 2000;192(7):1069-74.

  7. Yeaman MR, Yount NY. Mechanisms of antimicrobial peptide action and resistance. Pharmacol Rev. 2003;55(1):27-55.

  8. Cassagnes LE, Hervé V, Nepveu F, Hureau C, Faller P, Collin F. The catalytically active copper-amyloid-Beta state: coordination site responsible for reactive oxygen species production. AngewChemInt Ed Engl. 2013;52(42):11110-3.

  9. Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. BiochimBiophysActa. 2006 Sep;1758:1408–1425.

  10. Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Front Immunol. 2013;4:143.

  11. De Yang, Chen Q, Schmidt AP, Anderson GM, Wang JM, Wooters J, et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J Exp Med. 2000 Oct 2;192:1069–1074

  12. Niyonsaba F, Iwabuchi K, Someya A, Hirata M, Matsuda H, Ogawa H, et al. A cathelicidin family of human antibacterial peptide LL-37 induces mast cell chemotaxis. Immunology. 2002 May;106:20–26.

  13. Davidson DJ, Currie AJ, Reid GSD, Bowdish DME, MacDonald KL, Ma RC, et al. The cationic antimicrobial peptide LL-37 modulates dendritic cell differentiation and dendritic cell-induced T cell polarization. J ImmunolBaltimMd 1950. 2004 Jan 15;172:1146–1156.

  14. Pistolic J, Cosseau C, Li Y, Yu JJ, Filewod NCJ, Gellatly S, et al. Host defence peptide LL-37 induces IL-6 expression in human bronchial epithelial cells by activation of the NF-kappaB signaling pathway. J Innate Immun. 2009;1:254–267.

  15. Montreekachon P, Chotjumlong P, Bolscher JGM, Nazmi K, Reutrakul V, Krisanaprakornkit S. Involvement of P2X(7) purinergic receptor and MEK1/2 in interleukin-8 up-regulation by LL-37 in human gingival fibroblasts. J Periodontal Res. 2011 Jun;46:327–337.

  16. Gombart AF, Bhan I, Borregaard N, et al. Low plasma level of cathelicidin antimicrobial peptide (hCAP18) predicts increased infectious disease mortality in patients undergoing hemodialysis. Clin Infect Dis. 2009;48(4):418-24

  17. Ong PY, Ohtake T, Brandt C, Strickland I, Boguniewicz M, Ganz T, Gallo RL, Leung DY. Endogenous antimicrobial peptides and skin infections in atopic dermatitis. N Engl J Med. 2002 Oct 10;347(15):1151-60. doi: 10.1056/NEJMoa021481. PMID: 12374875.

  18. Ciornei CD, Sigurdardóttir T, Schmidtchen A, Bodelsson M. Antimicrobial and chemoattractant activity, lipopolysaccharide neutralization, cytotoxicity, and inhibition by serum of analogs of human cathelicidin LL-37. Antimicrob Agents Chemother. 2005 Jul;49(7):2845-50. doi: 10.1128/AAC.49.7.2845-2850.2005. PMID: 15980359; PMCID: PMC1168709.

  19. Chen X, Niyonsaba F, Ushio H, Okuda D, Nagaoka I, Ikeda S, Okumura K, Ogawa H. Synergistic effect of antibacterial agents human beta-defensins, cathelicidin LL-37 and lysozyme against Staphylococcus aureus and Escherichia coli. J Dermatol Sci. 2005 Nov;40(2):123-32. doi: 10.1016/j.jdermsci.2005.03.014. Epub 2005 Jun 15. PMID: 15963694.

  20. Elenius V, Palomares O, Waris M, et al. The relationship of serum vitamins A, D, E and LL-37 levels with allergic status, tonsillar virus detection and immune response. PLoS ONE. 2017;12(2):e0172350.

  21. Mookherjee, N. et al. Modulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J Immunol 176, 2455–2464 (2006).

  22. Pancreatic β-Cells Limit Autoimmune Diabetes via an Immunoregulatory Antimicrobial Peptide Expressed under the Influence of the Gut Microbiota. Sun J, Furio L, Mecheri R, van der Does AM, Lundeberg E, Saveanu L, Chen Y, van Endert P, Agerberth B, Diana J. Immunity. 2015 Aug 18;43(2):304-17.

  23. Kahlenberg JM, Kaplan MJ. Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J Immunol. 2013;191(10):4895-901.

  24. Yu X, Quan J, Long W, et al. LL-37 inhibits LPS-induced inflammation and stimulates the osteogenic differentiation of BMSCs via P2X7 receptor and MAPK signaling pathway. Exp Cell Res. 2018;372(2):178-187.

  25. Tjabringa GS, Rabe KF, Hiemstra PS. The human cathelicidin LL-37: a multifunctional peptide involved in infection and inflammation in the lung. PulmPharmacolTher. 2005;18(5):321-7.

  26. Jönsson D, Nilsson BO. The antimicrobial peptide LL-37 is anti-inflammatory and proapoptotic in human periodontal ligament cells. J Periodont Res. 2012;47(3):330-5.

  27. Alalwani SM, Sierigk J, Herr C, et al. The antimicrobial peptide LL-37 modulates the inflammatory and host defense response of human neutrophils. Eur J Immunol. 2010;40(4):1118–1126. doi:10.1002/eji.200939275.

  28. Chow LN, Choi KY, Piyadasa H, Bossert M, Uzonna J, Klonisch T, Mookherjee N. Human cathelicidin LL-37-derived peptide IG-19 confers protection in a murine model of collagen-induced arthritis. Mol Immunol. 2014 Feb;57(2):86-92. doi: 10.1016/j.molimm.2013.08.011. Epub 2013 Oct 1. PMID: 24091294.

  29. Choi KY, Napper S, Mookherjee N. Human cathelicidin LL-37 and its derivative IG-19 regulate interleukin-32-induced inflammation. Immunology. 2014 Sep;143(1):68-80. doi: 10.1111/imm.12291. PMID: 24666281; PMCID: PMC4137957.

  30. Hayashi M, Kuroda K, Ihara K, Iwaya T, Isogai E. Suppressive effect of an analog of the antimicrobial peptide of LL‑37 on colon cancer cells via exosome‑encapsulated miRNAs. Int J Mol Med. 2018;42(6):3009-3016.

  31. Ren SX, Cheng AS, To KF, et al. Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res. 2012;72(24):6512-23.

  32. Chen X, Zou X, Qi G, et al. Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell PhysiolBiochem. 2018;47(3):1060-1073.

  33. Kuroda K, Okumura K, Isogai H, Isogai E. The Human Cathelicidin Antimicrobial Peptide LL-37 and Mimics are Potential Anticancer Drugs. Front Oncol. 2015;5:144.

  34. Tjabringa GS, Aarbiou J, Ninaber DK, Drijfhout JW, Sørensen OE, Borregaard N, Rabe KF, Hiemstra PS: The antimicrobial peptide LL-37 activates innate immunity at the airway epithelial surface by transactivation of the epidermal growth factor receptor. J Immunol 2003; 171: 6690-6696.

  35. Piktel E, Niemirowicz K, Wnorowska U, Wątek M, Wollny T, Głuszek K, Góźdź S, Levental I, Bucki R: The role of cathelicidin LL-37 in cancer development. Arch ImmunolTherExp (Warsz) 2016; 64: 33-46.

  36. Choi KY, Napper S, Mookherjee N: Human cathelicidin LL-37 and its derivative IG-19 regulate interleukin-32-induced inflammation. Immunology 2014; 143: 68-80.

  37. Di Virgilio F, Falzoni S, Giuliani AL, Adinolfi E: P2 receptors in cancer progression and metastatic spreading. CurrOpinPharmacol 2016; 29: 17-25.

  38. Qiu Y, Li WH, Zhang HQ, Liu Y, Tian XX, Fang WG: P2X7 mediates ATP-driven invasiveness in prostate cancer cells. PLoS One 2014; 9:e114371.

  39. Cha HR, Lee JH, Hensel JA, Sawant AB, Davis BH, Lee CM, Deshane JS, Ponnazhagan S: Prostate cancer-derived cathelicidin-related antimicrobial peptide facilitates macrophage differentiation and polarization of immature myeloid progenitors to protumorigenic macrophages. Prostate 2016; 76: 624-636.

  40. Roger S, Jelassi B, Couillin I, Pelegrin P, Besson P, Jiang LH: Understanding the roles of the P2X7 receptor in solid tumour progression and therapeutic perspectives. BiochimBiophysActa 2015; 1848: 2584-2602.

  41. Piktel E, Niemirowicz K, Wnorowska U, Wątek M, Wollny T, Głuszek K, Góźdź S, Levental I, Bucki R: The role of cathelicidin LL-37 in cancer development. Arch ImmunolTherExp (Warsz) 2016; 64: 33-46.

  42. Tuomela JM, Sandholm JA, Kaakinen M, Hayden KL, Haapasaari KM, Jukkola-Vuorinen A, Kauppila JH, Lehenkari PP, Harris KW, Graves DE, Selander KS: Telomeric G-quadruplex-forming DNA fragments induce TLR9-mediated and LL-37-regulated invasion in breast cancer cells in vitro. Breast Cancer Res Treat 2016; 155: 261-271.

  43. Wu WK, Wang G, Coffelt SB, Betancourt AM, Lee CW, Fan D, Wu K, Yu J, Sung JJ, Cho CH: Emerging roles of the host defense peptide LL-37 in human cancer and its potential therapeutic applications. Int J Cancer 2010; 127: 1741-1747.

  44. Wu WK, Sung JJ, To KF, Yu L, Li HT, Li ZJ, Chu KM, Yu J, Cho CH: The host defense peptide LL-37 activates the tumor-suppressing bone morphogenetic protein signaling via inhibition of proteasome in gastric cancer cells. J Cell Physiol 2010; 223: 178-186.

  45. An LL, Ma XT, Yang YH, Lin YM, Song YH, Wu KF: Marked reduction of LL-37/hCAP-18, an antimicrobial peptide, in patients with acute myeloid leukemia. Int J Hematol 2005; 81: 45-7.

  46. Chen X, Qi G, Qin M, Zou Y, Zhong K, Tang Y, Guo Y, Jiang X, Liang L, Zou X: DNA methylation directly downregulates human cathelicidin antimicrobial peptide gene (CAMP) promoter activity. Oncotarget 2017; 8: 27943-27952.

  47. Piktel E, Niemirowicz K, Wnorowska U, Wątek M, Wollny T, Głuszek K, Góźdź S, Levental I, Bucki R: The role of cathelicidin LL-37 in cancer development. Arch ImmunolTherExp (Warsz) 2016; 64: 33-46.

  48. Tuomela JM, Sandholm JA, Kaakinen M, Hayden KL, Haapasaari KM, Jukkola-Vuorinen A, Kauppila JH, Lehenkari PP, Harris KW, Graves DE, Selander KS: Telomeric G-quadruplex-forming DNA fragments induce TLR9-mediated and LL-37-regulated invasion in breast cancer cells in vitro. Breast Cancer Res Treat 2016; 155: 261-271.

  49. Ren SX, Cheng AS, To KF, Tong JH, Li MS, Shen J, Wong CC, Zhang L, Chan RL, Wang XJ, Ng SS, Chiu LC, Marquez VE, Gallo RL, Chan FK, Yu J, Sung JJ, Wu WK, Cho CH: Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res 2012; 72: 6512-6523.

  50. Niemirowicz K, Prokop I, Wilczewska AZ, Wnorowska U, Piktel E, Wątek M, Savage PB, Bucki R: Magnetic nanoparticles enhance the anti-cancer activity of cathelicidin LL-37 peptide against colon cancer cells. Int J Nanomedicine 2015; 10: 3843-3853.

  51. Niemirowicz K, Durnaś B, Tokajuk G, Piktel E, Michalak G, Gu X, Kułakowska A, Savage PB, Bucki R: Formulation and candidacidal activity of magnetic nanoparticles coated with cathelicidin LL-37 and ceragenin CSA-13. Sci Rep 2017; 7: 4610.

  52. Wu WK, Sung JJ, To KF, Yu L, Li HT, Li ZJ, Chu KM, Yu J, Cho CH: The host defense peptide LL-37 activates the tumor-suppressing bone morphogenetic protein signaling via inhibition of proteasome in gastric cancer cells. J Cell Physiol 2010; 223: 178-186.

  53. Wu WK, Cho CH, Lee CW, Wu K, Fan D, Yu J, Sung JJ: Proteasome inhibition: a new therapeutic strategy to cancer treatment. Cancer Lett 2010; 293: 15-22.

  54. Prevete N, Liotti F, Visciano C, Marone G, Melillo RM, de Paulis A: The formyl peptide receptor 1 exerts a tumor suppressor function in human gastric cancer by inhibiting angiogenesis. Oncogene 2015; 34: 3826-3838.

  55. Li L, Chen K, Xiang Y, Yoshimura T, Su S, Zhu J, Bian XW, Wang JM: New development in studies of formyl-peptide receptors: critical roles in host defense. J LeukocBiol 2016; 99: 425-435.

  56. Mader JS, Mookherjee N, Hancock RE, Bleackley RC: The human host defense peptide LL-37 induces apoptosis in a calpain- and apoptosis-inducing factor-dependent manner involving Bax activity. Mol Cancer Res 2009; 7: 689-702.

  57. Yang D, Chertov O, Oppenheim JJ: Participation of mammalian defensins and cathelicidins in antimicrobial immunity: receptors and activities of human defensins and cathelicidin (LL-37). J LeukocBiol 2001; 69: 691-697.

  58. Okumura K, Itoh A, Isogai E, Hirose K, Hosokawa Y, Abiko Y, Shibata T, Hirata M, Isogai H: C-terminal domain of human CAP18 antimicrobial peptide induces apoptosis in oral squamous cell carcinoma SAS-H1 cells. Cancer Lett 2004; 212: 185-194.

  59. Chen X, Qi G, Qin M, Zou Y, Zhong K, Tang Y, Guo Y, Jiang X, Liang L, Zou X: DNA methylation directly downregulates human cathelicidin antimicrobial peptide gene (CAMP) promoter activity. Oncotarget 2017; 8: 27943-27952.

  60. Available from https://www.promorepharma.com/en/ll-37-healing-of-chronic-wounds/.

  61. Ramos R, Silva JP, Rodrigues AC, et al. Wound healing activity of the human antimicrobial peptide LL37. Peptides. 2011;32(7):1469-76.

  62. Shaykhiev R, Beisswenger C, Kändler K, et al. Human endogenous antibiotic LL-37 stimulates airway epithelial cell proliferation and wound closure. Am J Physiol Lung Cell Mol Physiol. 2005;289(5):L842-8.

  63. Carretero M, Escámez MJ, García M, et al. In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37. J Invest Dermatol. 2008;128(1):223-36.

  64. Heilborn JD, Nilsson MF, Kratz G, et al. J Invest Dermatol. 2003;120:379–389.

  65. Saporito P, Vangmouritzen M, Løbner-olesen A, Jenssen H. LL-37 fragments have antimicrobial activity against Staphylococcus epidermidis biofilms and wound healing potential in HaCaT cell line. J Pept Sci. 2018;24(7):e3080.

  66. Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Front Immunol. 2013;4:143. Published 2013 Jul 3. doi:10.3389/fimmu.2013.00143.

  67. Grönberg A, Mahlapuu M, Ståhle M, Whately-smith C, Rollman O. Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair Regen. 2014;22(5):613-21.

  68. Edfeldt K, Agerberth B, Rottenberg ME, Gudmundsson GH, Wang XB, Mandal K, Xu Q, Yan ZQ. Involvement of the antimicrobial peptide LL-37 in human atherosclerosis. Arterioscler Thromb Vasc Biol. 2006 Jul;26(7):1551-7. doi: 10.1161/01.ATV.0000223901.08459.57. Epub 2006 Apr 27. PMID: 16645154..

  69. Bei Y, Pan LL, Zhou Q, Zhao C, Xie Y, Wu C, Meng X, Gu H, Xu J, Zhou L, Sluijter JPG, Das S, Agerberth B, Sun J, Xiao J. Cathelicidin-related antimicrobial peptide protects against myocardial ischemia/reperfusion injury. BMC Med. 2019 Feb 20;17(1):42. doi: 10.1186/s12916-019-1268-y. PMID: 30782145; PMCID: PMC6381635.

  70. Zhou Q, Pan LL, Xue R, et al. The anti-microbial peptide LL-37/CRAMP levels are associated with acute heart failure and can attenuate cardiac dysfunction in multiple preclinical models of heart failure. Theranostics. 2020;10(14):6167-6181. Published 2020 May 15. doi:10.7150/thno.46225.

  71. Qin X, Zhu G, Huang L, Zhang W, Huang Y, Xi X. LL-37 and its analog FF/CAP18 attenuate neutrophil migration in sepsis-induced acute lung injury. J Cell Biochem. 2019 Apr;120(4):4863-4871. doi: 10.1002/jcb.27641. Epub 2018 Dec 9. PMID: 30537236.

  72. Available at https://www.jacionline.org/article/S0091-6749(06)00727-5/abstract#articleInformation.

  73. Zhang Z, Shively JE. Generation of novel bone forming cells (monoosteophils) from the cathelicidin-derived peptide LL-37 treated monocytes. PLoS One. 2010 Nov 15;5(11):e13985. doi: 10.1371/journal.pone.0013985. PMID: 21085494; PMCID: PMC2981577.

  74. Yu X, Quan J, Long W, Chen H, Wang R, Guo J, Lin X, Mai S. LL-37 inhibits LPS-induced inflammation and stimulates the osteogenic differentiation of BMSCs via P2X7 receptor and MAPK signaling pathway. Exp Cell Res. 2018 Nov 15;372(2):178-187. doi: 10.1016/j.yexcr.2018.09.024. Epub 2018 Oct 1. PMID: 30287143.

  75. Supanchart C, Thawanaphong S, Makeudom A, Bolscher JG, Nazmi K, Kornak U, Krisanaprakornkit S. The antimicrobial peptide, LL-37, inhibits in vitro osteoclastogenesis. J Dent Res. 2012 Nov;91(11):1071-7. doi: 10.1177/0022034512460402. Epub 2012 Sep 13. PMID: 22983411.

  76. Kittaka M, Shiba H, Kajiya M, Fujita T, Iwata T, Rathvisal K, Ouhara K, Takeda K, Fujita T, Komatsuzawa H, Kurihara H. The antimicrobial peptide LL37 promotes bone regeneration in a rat calvarial bone defect. Peptides. 2013 Aug;46:136-42. doi: 10.1016/j.peptides.2013.06.001. Epub 2013 Jun 12. PMID: 23770151.

  77. He Y, Mu C, Shen X, Yuan Z, Liu J, Chen W, Lin C, Tao B, Liu B, Cai K. Peptide LL-37 coating on micro-structured titanium implants to facilitate bone formation in vivo via mesenchymal stem cell recruitment. Acta Biomater. 2018 Oct 15;80:412-424. doi: 10.1016/j.actbio.2018.09.036. Epub 2018 Sep 25. PMID: 30266635.

Other Peptides

CJC-1295

Low Dose Naltrexone

Kisspeptin

Cerebrolysin

PE-22-28

Success Stories

men testimonial before after

At the age of 60, I look and feel better than I ever have in my entire life! Switching my health program and hormone replacement therapy regimen over to Genemedics was one of the best decisions I’ve ever made in my life! Genemedics and Dr George have significantly improved my quality of life and also dramatically improved my overall health. I hav...
Nick Cassavetes ,60 yrs old Movie Director (“The Notebook”, “John Q”, “Alpha Dog”), Actor and Writer

See All Men’s Testimonials

Call 800-277-4041 for a Free Consultation

What to expect during your consultation:
  • Usually takes 15-30 minutes
  • Completely confidential
  • No obligation to purchase anything
  • We will discuss your symptoms along with your health and fitness goals
  • Free post-consult access for any additional questions you may have

About

Genemedics® Health Institute is a global premier institute dedicated to revolutionizing health and medicine through healthy lifestyle education, guidance and accountability in harmony with functional medicine. Our physician-supervised health programs are personally customized to help you reach your health and fitness goals while looking and feeling better than ever.

Quick Links

Our Services

 Our Locations

genemedics logo

280 North Old Woodward Ave. Suite 210 Birmingham MI 48009,USA

800-277-4041

info@genemedics.com

© Copyright Genemedics Health Institute. All Rights Reserved. Privacy Policy.

Back to Top
-

Free Consultation

STEPS AWAY FROM A YOUNGER. HEALTHIER YOU!

Call 800-277-4041 for a Free Consultation

What to expect during your consultation:

  • Usually takes 15-30 minutes
  • Completely confidential
  • No obligation to purchase anything
  • We will discuss your symptoms along with your health and fitness goals
  • Free post-consult access for any additional questions you may have
Captch Background